معرفی شرکت ها


bialign-0.3b5


Card image cap
تبلیغات ما

مشتریان به طور فزاینده ای آنلاین هستند. تبلیغات می تواند به آنها کمک کند تا کسب و کار شما را پیدا کنند.

مشاهده بیشتر
Card image cap
تبلیغات ما

مشتریان به طور فزاینده ای آنلاین هستند. تبلیغات می تواند به آنها کمک کند تا کسب و کار شما را پیدا کنند.

مشاهده بیشتر
Card image cap
تبلیغات ما

مشتریان به طور فزاینده ای آنلاین هستند. تبلیغات می تواند به آنها کمک کند تا کسب و کار شما را پیدا کنند.

مشاهده بیشتر
Card image cap
تبلیغات ما

مشتریان به طور فزاینده ای آنلاین هستند. تبلیغات می تواند به آنها کمک کند تا کسب و کار شما را پیدا کنند.

مشاهده بیشتر
Card image cap
تبلیغات ما

مشتریان به طور فزاینده ای آنلاین هستند. تبلیغات می تواند به آنها کمک کند تا کسب و کار شما را پیدا کنند.

مشاهده بیشتر

توضیحات

Bialignment of RNAs and proteins
ویژگی مقدار
سیستم عامل -
نام فایل bialign-0.3b5
نام bialign
نسخه کتابخانه 0.3b5
نگهدارنده ['Sebastian Will']
ایمیل نگهدارنده ['sebastian.will@polytechnique.edu']
نویسنده Sebastian Will
ایمیل نویسنده sebastian.will@polytechnique.edu
آدرس صفحه اصلی https://github.com/s-will/BiAlign
آدرس اینترنتی https://pypi.org/project/bialign/
مجوز -
# BiAlign - Bialignment of RNAs and proteins The tool BiAlign computes optimal bi-alignments of RNAs and proteins. Such bi-alignments support evolutionary 'shift' events between sequence and structure. In this way, bialignments extend alignments based on sequence and struture similarity to the case of potential incongruence between sequence and structure evolution. The current version extends the capabilities from RNA alignments to the alignment of protein sequence and secondary structure, supporting realistic 'affine' gap cost with gap opening and extension scores. ![](Examples/example.svg) The first version of this tool has been described in Waldl M., Will S., Wolfinger M.T., Hofacker I.L., Stadler P.F. (2020) Bi-alignments as Models of Incongruent Evolution of RNA Sequence and Secondary Structure. In: Cazzaniga P., Besozzi D., Merelli I., Manzoni L. (eds) Computational Intelligence Methods for Bioinformatics and Biostatistics. CIBB 2019. Lecture Notes in Computer Science, vol 12313. Springer, Cham. https://doi.org/10.1007/978-3-030-63061-4_15 ## Installation This software will run with full functionality only on Linux and Mac systems. Installation via conda is not supported on Windows and the prediction of RNA structures (using the Vienna RNA package) cannot be supported. The software can be installed via Conda (only Linux/Mac) or pip (Mac/Linux/Windows/...) respectively by ``` conda install -c bioconda bialign ``` or ``` pip install bialign ``` Conda installation is recommended, since it will automatically install dependencies like the Vienna RNA package. When installing via pip (or from source, see below), additionally install numpy, matplotlib, and (optionally) the Vienna RNA package. ### Installation from source Installation or from source, e.g. a clone of the git repository, relies on the python setup system. We require Cython to compile performance critical code. For this purpose Cython and Python (including pip/setuptools) need to be installed. Install from source by ``` pip install . ``` Moreover, for aligning RNAs, the tool requires the Vienna RNA package with Python bindings. We recommend to use the tool under Linux or MacOS and install the prerequisites via conda / bioconda. ## Usage examples The tool can be used from the command line or via its Python interface (e.g. from a Jupyter notebook). ### Command line interface To get an overview on all command line parameters that configure modes and alignment parameters, please refer to the help output of the tool as obtained by ``` bialign.py --help ``` #### RNA bi-alignment examples This 'toy' example demonstrates a simple helix shift: ```bash bialign.py GCGGGGGAUAUCCCCAUCG GGGGAUAUCCCCAUCG \ --strA "...(((.....)))....." --strB ".(((.....)))...." \ --structure 400 \ --gap_opening_cost -200 --gap_cost -50 \ --max_shift 1 --shift_cost -150 ``` Using default text output mode, this produces ``` Input: seqA GCGGGGGAUAUCCCCAUCG seqB GGGGAUAUCCCCAUCG strA ...(((.....)))..... strB .(((.....))).... SCORE: 6800 A GCGGGGGAUAUCCCC-AUCG B G---GGGAUAUCCCC-AUCG A ss ...-(((.....)))..... B ss .---(((.....)))-.... A shifts ...<...........>.... B shifts .................... ``` Structures will be predicted (using the Vienna RNA package) if they are not explicitly given, e.g. ``` bialign.py UGUAAACAUCCUCGACUGGAAGCUGUGAAGCCACAAAUGGGCUUUCAGUCGGAUGUUUGCA UGUAAACAUCCUACACUCAGCUGUCAUACAUGCGUUGGCUGGGAUGUGGAUGUUUACG ``` Note that this fails, if the Vienna RNA package with Python binding is not available. #### Bi-Alignments of proteins with affine gap cost ```bash bialign.py RAKLPLKEKKLTATANYHPGIRYIMTGYSAKYIYSSTYARFR KAKLPLKEKKLTRTANYHPGIRYIMTGYSAKRIYSSTYAYFR \ --strA "CHHHHHHHHHHHHHCCCCTCEEEEEEECCTCEEEEEEEECCC" --strB "HHHHHHHHHHHHCCCCCCTCEEEEEEECCCCCEEEEEEEECC" \ --type Protein --shift_cost -150 --structure_weight 800 --simmatrix BLOSUM62 --gap_opening_cost -150 \ --gap_cost -50 --max_shift 1 --outmode sorted ``` Due to the requested output mode `sorted`, this produces text output with BLAST-like annotation by the respective consensus sequence and structure of the sequence and structure alignment component. ``` Input: seqA RAKLPLKEKKLTATANYHPGIRYIMTGYSAKYIYSSTYARFR seqB KAKLPLKEKKLTRTANYHPGIRYIMTGYSAKRIYSSTYAYFR strA CHHHHHHHHHHHHHCCCCTCEEEEEEECCTCEEEEEEEECCC strB HHHHHHHHHHHHCCCCCCTCEEEEEEECCCCCEEEEEEEECC SCORE: 48500 A ss -CHHHHHHHHHHHHHCCCCTCEEEEEEECCTCEEEEEEEEC-CC A -RAKLPLKEKKLTATANYHPGIRYIMTGYSAKYIYSSTYAR-FR consensus -.AKLPLKEKKLT.TANYHPGIRYIMTGYSAK.IYSSTYA.-FR B -KAKLPLKEKKLTRTANYHPGIRYIMTGYSAKRIYSSTYAY-FR B ss -HHHHHHHHHHHHCCCCCCTCEEEEEEECCCCCEEEEEEEE-CC consensus ss -.HHHHHHHHHHH..CCCCTCEEEEEEECC.C.EEEEEEE.-CC A RAKLPLKEKKLTA-TANYHPGIRYIMTGYSAK-YIYSSTYARFR A ss CHHHHHHHHHHHH-HCCCCTCEEEEEEECCTC-EEEEEEEECCC consensus ss .HHHHHHHHHHHH..CCCCTCEEEEEEECC.C.EEEEEEEE.CC B ss -HHHHHHHHHHHHCCCCCCTCEEEEEEECCCCCEEEEEEEE-CC B -KAKLPLKEKKLTRTANYHPGIRYIMTGYSAKRIYSSTYAY-FR consensus .........K....TANYHPGIRYIMTGYSAK....S.....FR A shifts >............<..................<........>.. B shifts ............................................ ``` Input can also be read from files as written by the secondary structure prediction web server CFSSP (Kumar et al, 2013; http://www.biogem.org/tool/chou-fasman). ```bash bialign.py --filein Examples/DNAPolymerase1_Escherichia.cfssp Examples/DNAPolymerase1_Xanthomonas.cfssp \ --type Protein --shift_cost -150 --structure_weight 800 --simmatrix BLOSUM62 --gap_opening_cost -150 \ --gap_cost -50 --max_shift 1 ``` ### Python interface The following code generates a bi-alignment of two toy proteins and shows the resulting alignment in a graphical representation. ```python import bialignment import bialignment as ba import timeit args = {'type': 'Protein', 'gap_cost': -50, 'gap_opening_cost': -150, 'shift_cost': -150, 'structure_weight': 800, 'max_shift': 1, 'simmatrix': 'BLOSUM62' } args['nameA'] = 'A' args['nameB'] = 'B' strA = "CHHHHHHHHHHHHHCCCCTCEEEEEEECCTCEEEEEEEECCC" seqA = "RAKLPLKEKKLTATANYHPGIRYIMTGYSAKYIYSSTYARFR" seqB = "KAKLPLKEKKLTRTANYHPGIRYIMTGYSAKRIYSSTYAYFR" strB = "HHHHHHHHHHHHCCCCCCTCEEEEEEECCCCCEEEEEEEECC" bialigner = ba.BiAligner(seqA, seqB, strA, strB, **args) score = bialigner.optimize() print('SCORE',score) print() for line in bialigner.decode_trace(): print(line) ba.plot_alignment(bialigner.decode_trace_full(), width = 80, show_position_numbers=False, name_offset=3, #outname = "example.svg" #optionally write plot to file ) ``` ![](Examples/example.svg)


نحوه نصب


نصب پکیج whl bialign-0.3b5:

    pip install bialign-0.3b5.whl


نصب پکیج tar.gz bialign-0.3b5:

    pip install bialign-0.3b5.tar.gz