معرفی شرکت ها
antiberty-0.1.0
تبلیغات ما
مشتریان به طور فزاینده ای آنلاین هستند. تبلیغات می تواند به آنها کمک کند تا کسب و کار شما را پیدا کنند.
مشاهده بیشتر
تبلیغات ما
مشتریان به طور فزاینده ای آنلاین هستند. تبلیغات می تواند به آنها کمک کند تا کسب و کار شما را پیدا کنند.
مشاهده بیشتر
تبلیغات ما
مشتریان به طور فزاینده ای آنلاین هستند. تبلیغات می تواند به آنها کمک کند تا کسب و کار شما را پیدا کنند.
مشاهده بیشتر
تبلیغات ما
مشتریان به طور فزاینده ای آنلاین هستند. تبلیغات می تواند به آنها کمک کند تا کسب و کار شما را پیدا کنند.
مشاهده بیشتر
تبلیغات ما
مشتریان به طور فزاینده ای آنلاین هستند. تبلیغات می تواند به آنها کمک کند تا کسب و کار شما را پیدا کنند.
مشاهده بیشترتوضیحات
-
| ویژگی | مقدار |
|---|---|
| سیستم عامل | - |
| نام فایل | antiberty-0.1.0 |
| نام | antiberty |
| نسخه کتابخانه | 0.1.0 |
| نگهدارنده | [] |
| ایمیل نگهدارنده | [] |
| نویسنده | - |
| ایمیل نویسنده | - |
| آدرس صفحه اصلی | - |
| آدرس اینترنتی | https://pypi.org/project/antiberty/ |
| مجوز | - |
# AntiBERTy
Official repository for AntiBERTy, an antibody-specific transformer language model pre-trained on 558M natural antibody sequences, as described in [Deciphering antibody affinity maturation with language models and weakly supervised learning](https://arxiv.org/abs/2112.07782).
## Setup
To use AntiBERTy, install via pip:
```bash
pip install antiberty
```
Alternatively, you can clone this repository and install the package locally:
```bash
$ git clone git@github.com:jeffreyruffolo/AntiBERTy.git
$ pip install AntiBERTy
```
## Usage
### Embeddings
To use AntiBERTy to generate sequence embeddings, use the `embed` function. The output is a list of embedding tensors, where each tensor is the embedding for the corresponding sequence. Each embedding has dimension `[(Length + 2) x 512]`.
```python
from antiberty import AntiBERTyRunner
antiberty = AntiBERTyRunner()
sequences = [
"EVQLVQSGPEVKKPGTSVKVSCKASGFTFMSSAVQWVRQARGQRLEWIGWIVIGSGNTNYAQKFQERVTITRDMSTSTAYMELSSLRSEDTAVYYCAAPYCSSISCNDGFDIWGQGTMVTVS",
"DVVMTQTPFSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPYTFGGGTKLEIK",
]
embeddings = antiberty.embed(sequences)
```
To access the attention matrices, pass the `return_attention` flag to the `embed` function. The output is a list of attention matrices, where each matrix is the attention matrix for the corresponding sequence. Each attention matrix has dimension `[Layer x Heads x (Length + 2) x (Length + 2)]`.
```python
from antiberty import AntiBERTyRunner
antiberty = AntiBERTyRunner()
sequences = [
"EVQLVQSGPEVKKPGTSVKVSCKASGFTFMSSAVQWVRQARGQRLEWIGWIVIGSGNTNYAQKFQERVTITRDMSTSTAYMELSSLRSEDTAVYYCAAPYCSSISCNDGFDIWGQGTMVTVS",
"DVVMTQTPFSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPYTFGGGTKLEIK",
]
embeddings, attentions = antiberty.embed(sequences, return_attention=True)
```
The `embed` function can also be used with masked sequences. Masked residues should be indicated with underscores.
### Classification
To use AntiBERTy to predict the species and chain type of sequences, use the `classify` function. The output is two lists of classifications for each sequences.
```python
from antiberty import AntiBERTyRunner
antiberty = AntiBERTyRunner()
sequences = [
"EVQLVQSGPEVKKPGTSVKVSCKASGFTFMSSAVQWVRQARGQRLEWIGWIVIGSGNTNYAQKFQERVTITRDMSTSTAYMELSSLRSEDTAVYYCAAPYCSSISCNDGFDIWGQGTMVTVS",
"DVVMTQTPFSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPYTFGGGTKLEIK",
]
species_preds, chain_preds = antiberty.classify(sequences)
```
The `classify` function can also be used with masked sequences. Masked residues should be indicated with underscores.
### Mask prediction
To use AntiBERTy to predict the identity of masked residues, use the `fill_masks` function. Masked residues should be indicated with underscores. The output is a list of filled sequences, corresponding to the input masked sequences.
```python
from antiberty import AntiBERTyRunner
antiberty = AntiBERTyRunner()
sequences = [
"____VQSGPEVKKPGTSVKVSCKASGFTFMSSAVQWVRQARGQRLEWIGWIVIGSGN_NYAQKFQERVTITRDM__STAYMELSSLRSEDTAVYYCAAPYCSSISCNDGFD____GTMVTVS",
"DVVMTQTPFSLPV__GDQASISCRSSQSLVHSNGNTY_HWYLQKPGQSPKLLIYKVSNRFSGVPDRFSG_GSGTDFTLKISRVEAEDLGVYFCSQSTHVPYTFGG__KLEIK",
]
filled_sequences = antiberty.fill_masks(sequences)
```
## Citing this work
```bibtex
@article{ruffolo2021deciphering,
title = {Deciphering antibody affinity maturation with language models and weakly supervised learning},
author = {Ruffolo, Jeffrey A and Gray, Jeffrey J and Sulam, Jeremias},
journal = {arXiv preprint arXiv:2112.07782},
year= {2021}
}
```
نیازمندی
| مقدار | نام |
|---|---|
| >=1.7.1 | torch |
| >=4.5.1 | transformers |
نحوه نصب
نصب پکیج whl antiberty-0.1.0:
pip install antiberty-0.1.0.whl
نصب پکیج tar.gz antiberty-0.1.0:
pip install antiberty-0.1.0.tar.gz