معرفی شرکت ها
alphaPredict-1.0
تبلیغات ما
مشتریان به طور فزاینده ای آنلاین هستند. تبلیغات می تواند به آنها کمک کند تا کسب و کار شما را پیدا کنند.
مشاهده بیشتر
تبلیغات ما
مشتریان به طور فزاینده ای آنلاین هستند. تبلیغات می تواند به آنها کمک کند تا کسب و کار شما را پیدا کنند.
مشاهده بیشتر
تبلیغات ما
مشتریان به طور فزاینده ای آنلاین هستند. تبلیغات می تواند به آنها کمک کند تا کسب و کار شما را پیدا کنند.
مشاهده بیشتر
تبلیغات ما
مشتریان به طور فزاینده ای آنلاین هستند. تبلیغات می تواند به آنها کمک کند تا کسب و کار شما را پیدا کنند.
مشاهده بیشتر
تبلیغات ما
مشتریان به طور فزاینده ای آنلاین هستند. تبلیغات می تواند به آنها کمک کند تا کسب و کار شما را پیدا کنند.
مشاهده بیشترتوضیحات
-
| ویژگی | مقدار |
|---|---|
| سیستم عامل | - |
| نام فایل | alphaPredict-1.0 |
| نام | alphaPredict |
| نسخه کتابخانه | 1.0 |
| نگهدارنده | [] |
| ایمیل نگهدارنده | [] |
| نویسنده | Holehouse Lab - Washington University School of Medicine |
| ایمیل نویسنده | remenecker@wustl.edu |
| آدرس صفحه اصلی | - |
| آدرس اینترنتی | https://pypi.org/project/alphaPredict/ |
| مجوز | MIT |
# alphaPredict: A predictor of AlphaFold2 confidence scores
**alphaPredict** uses a bidirectional recurrent neural network (BRNN) trained on the per residue pLDDT (predicted IDDT-Ca) confidence scores generated by AlphaFold2 (AF2). The confidence scores from 21 proteomes (about 363,000 total protein sequences) were used to train the BRNN behind alphaPredict. These confidence scores measure the local confidence that AlphaFold2 has in its predicted structure. The scores go from 0-100 where 0 represents low confidence and 100 represents high confidence. For more information, please see: *Highly accurate protein structure prediction with AlphaFold* https://doi.org/10.1038/s41586-021-03819-2. In describing these scores, the team states that regionds with pLDDT scores of less than 50 should not be interpreted except as *possible* disordered regions.
## Which proteomes were used to generate the network used by alphaPredict?
The confidence scores (pLDDT) from the proteomes of *Danio rerio*, *Candida albicans*, *Mus musculus*, *Escherichia coli*, *Drosophila melanogaster*, *Methanocaldococcus jannaschii*, *Plasmodium falciparum*, *Mycobacterium tuberculosis*, *Caenorhabditis elegans*, *Dictyostelium discoideum*, *Trypanosoma cruzi*, *Saccharomyces cerevisiae*, *Schizosaccharomyces pombe*, *Rattus norvegicus*, *Homo sapiens*, *Arabidopsis thaliana*, *Zea mays*, *Leishmania infantum*, *Staphylococcus aureus*, *Glycine max*, *Oryza sativa* were used to generate the BRNN (V4 and up).
## Why is alphaPredict useful?
**alphaPredict** allows for rapid generation of predicted AF2 residue-by-residue confidence scores of any protein of interest. This can be used for many applications such as generating a quick preview of which regions of your protein of interest AF2 might be able to predict with high confidence, or which regions of your protein *might* be disordered. AF2 is not (strictly speaking) a disorder predictor, and the confidence scores are not directly representative of protein disorder. Therefore, any conclusions drawn with regards to disorder from predicted AF2 confidence scores should be interpreted with care, but they may be able to provide an additional metric to assess the likelihood that any given protein region may be disordered.
## How accurate is alphaPredict?
The current BRNN (V7) has on average an ~8% error per residue. This is the average error rate for the V7 network. We are currently waiting on a new computer to try to generate new networks using more data, so this will be the most accurate network for the forseeable future. If you choose to use other networks:
V1 has an average per residue error rate of about 11.5%
V2 has an average per residue error rate of about 9.5%
V3 through V6 were all networks that were tweaked before finishing V7, so I don't have those numbers on hand. They have errors of between 8.5% and 11% per residue.
## Installation:
**alphaPredict** is available through PyPI - to install simply run
$ pip install alphaPredict
Alternatively, you can get **alphaPredict** directly from GitHub.
To clone the GitHub repository and gain the ability to modify a local copy of the code, run
$ git clone https://github.com/ryanemenecker/alphaPredict.git
$ cd alphapredict
$ pip install .
This will install **alphapredict** locally.
## Usage:
**alphaPredict** is usable from Python.
## Using alphaPredict from Python
First import alphaPredict -
import alphaPredict as alpha
Once imported, you can begin to generate predicted confidence scores.
### Predicting Confidence Scores
The ``alpha.predict()`` function will return a list of predicted confidence scores for each residue of the input sequence. The input sequence should be a string. Running -
alpha.predict("DSSPEAPAEPPKDVPHDWLYSYVFLTHHPADFLR")
would output -
[39.5097, 43.5166, 46.9381, 55.6352, 54.2278, 56.5101, 60.3866, 58.0785, 60.2979, 65.6772, 69.3595, 66.0048, 68.0264, 68.4496, 71.1201, 70.3302, 73.5393, 76.7108, 81.8086, 85.8871, 86.4789, 87.4088, 88.8859, 87.3609, 84.9879, 79.5814, 80.5888, 79.3752, 79.8667, 83.2751, 83.6576, 81.2429, 78.8213, 72.8758]
### Graphing Confidence Scores
The ``alpha.graph()`` function will return a graph of predicted confidence scores for each residue of the input sequence. The input sequence should be a string. Running -
alpha.graph("MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY")
would generate -
## Acknowledgements
We would like to thank the **DeepMind** team for developing AlphaFold.
We would like to thank **Dan Griffith** from the Holehouse Lab at Washington University School of Medicine for developing PARROT, which is the tool that was used to generate the BRNN behind alphaPredict. For more info (and if you want to generate machine-learning networks for predicting anything related to proteins) see: https://idptools-parrot.readthedocs.io/en/latest/.
زبان مورد نیاز
| مقدار | نام |
|---|---|
| >=3.5 | Python |
نحوه نصب
نصب پکیج whl alphaPredict-1.0:
pip install alphaPredict-1.0.whl
نصب پکیج tar.gz alphaPredict-1.0:
pip install alphaPredict-1.0.tar.gz